Structure of PDB 7eiu Chain A Binding Site BS02

Receptor Information
>7eiu Chain A (length=148) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFL
YLRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISY
ANIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eiu Structural insights reveal the specific recognition of meiRNA by the Mei2 protein.
Resolution2.349 Å
Binding residue
(original residue number in PDB)		I681 K690
Binding residue
(residue number reindexed from 1)		I103 K112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7eiu, PDBe:7eiu, PDBj:7eiu
PDBsum7eiu
PubMed35512546
UniProtP08965|MEI2_SCHPO Meiosis protein mei2 (Gene Name=mei2)

[Back to BioLiP]