Structure of PDB 7eid Chain A Binding Site BS02

Receptor Information
>7eid Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eid Elucidation of binding preferences of YEATS domains to site-specific acetylated nucleosome core particles.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E57 F59 R61 P62 K63 R64 V65 K72 V73 E74
Binding residue
(residue number reindexed from 1)		E57 F59 R61 P62 K63 R64 V65 K72 V73 E74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7eid, PDBe:7eid, PDBj:7eid
PDBsum7eid
PubMed35732209
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]