Structure of PDB 7dwr Chain A Binding Site BS02

Receptor Information

>7dwr Chain A (length=220) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIVTVINQKGGVGKTTTSVNLSYYLSKEKKTGLLDLDPEGGATISYGMKR
ELKELPLGEKSVNIFNVEVFPAHIGLLKLELNGDVEEISNKIKEIGKQFD
FLVIDTPPNLGTLAISAMLVADRIVSPVTPQPLALEAIKNLDSRLKSIGK
NAYSFTNFSKKVVKLDNLSSVKFTEITIPPSRLFIEASRLGVPALRYEEV
RIKKPKLANYYQQLAKVISE

Ligand information

>7dwr Chain F (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tccctgtttcacgtggaacaccct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7dwr Chromosome segregation in Archaea: SegA- and SegB-DNA complex structures provide insights into segrosome assembly.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	G11 T129 Q131 F158
Binding residue (residue number reindexed from 1)	G11 T129 Q131 F158

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:7dwr, PDBe:7dwr, PDBj:7dwr
PDBsum	7dwr
PubMed	34850144
UniProt	Q981B3

[Back to BioLiP]