Structure of PDB 7dw5 Chain A Binding Site BS02

Receptor Information
>7dw5 Chain A (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQN
ERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFP
GIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dw5 DNA crosslinking and recombination-activating genes 1/2 (RAG1/2) are required for oncogenic splicing in acute lymphoblastic leukemia.
Resolution2.83 Å
Binding residue
(original residue number in PDB)		R21 R23 L24 W26 R62 N69
Binding residue
(residue number reindexed from 1)		R2 R4 L5 W7 R43 N50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7dw5, PDBe:7dw5, PDBj:7dw5
PDBsum7dw5
PubMed34699692
UniProtP0CJ85|DU4L2_HUMAN Double homeobox protein 4-like protein 2 (Gene Name=DUX4L2)

[Back to BioLiP]