Structure of PDB 7cvo Chain A Binding Site BS02

Receptor Information
>7cvo Chain A (length=130) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEE
NKRRTLQKNDIAAAITRTDIFDFLVDIVPRVTQLSPMDREARVLRYREKR
KTRKFEKTIRYASRKAYAEIRPRVNGRFAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cvo Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		P80 L81 A82 R83 M96 Y328 S330 R331 Y334 R338 R344 F345 K347
Binding residue
(residue number reindexed from 1)		P4 L5 A6 R7 M20 Y111 S113 R114 Y117 R121 R127 F128 K130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7cvo, PDBe:7cvo, PDBj:7cvo
PDBsum7cvo
PubMed33693873
UniProtQ39057|CONS_ARATH Zinc finger protein CONSTANS (Gene Name=CO);
Q9FMV5

[Back to BioLiP]