Structure of PDB 7csz Chain A Binding Site BS02

Receptor Information
>7csz Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIA
FVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEE
LTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYL
KPSQAAQAIENCDRSFRAILAEPKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7csz Structural basis for RNA recognition by the N-terminal tandem RRM domains of human RBM45.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R122 F124 V125 M126 I152 K155 Y165 R186 E191 P192 K193
Binding residue
(residue number reindexed from 1)		R103 F105 V106 M107 I133 K136 Y146 R167 E172 P173 K174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7csz, PDBe:7csz, PDBj:7csz
PDBsum7csz
PubMed33577684
UniProtQ8IUH3|RBM45_HUMAN RNA-binding protein 45 (Gene Name=RBM45)

[Back to BioLiP]