Structure of PDB 7csy Chain A Binding Site BS02

Receptor Information

>7csy Chain A (length=92) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMA
IRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL

Ligand information

>7csy Chain F (length=29) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcattaacccttaacgttaagcgttaact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7csy Pseudomonas aeruginosa antitoxin HigA functions as a diverse regulatory factor by recognizing specific pseudopalindromic DNA motifs.
Resolution	2.29 Å
Binding residue (original residue number in PDB)	S37 P39 T40 R49 G50 S52
Binding residue (residue number reindexed from 1)	S31 P33 T34 R43 G44 S46

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7csy, PDBe:7csy, PDBj:7csy
PDBsum	7csy
PubMed	33346387
UniProt	Q9HVC1

[Back to BioLiP]