Structure of PDB 7c4q Chain A Binding Site BS02

Receptor Information
>7c4q Chain A (length=54) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKMWSVQESEWLKQGVVRYGVGHWERIRSAFPFAGRTAVNLKDRWRTMV
KLKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c4q Crystal structure of DBD plasma treated zebrafish TRF2 myb-domain complexed with DNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R522 K523 W525 D564 R565 T568 K571
Binding residue
(residue number reindexed from 1)
R2 K3 W5 D44 R45 T48 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7c4q, PDBe:7c4q, PDBj:7c4q
PDBsum7c4q
PubMed
UniProtQ4FZZ9

[Back to BioLiP]