Structure of PDB 7c06 Chain A Binding Site BS02

Receptor Information
>7c06 Chain A (length=193) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNM
YKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGD
HLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQ
HETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c06 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
Resolution3.02 Å
Binding residue
(original residue number in PDB)
P173 Q174
Binding residue
(residue number reindexed from 1)
P172 Q173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0089701 U2AF complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7c06, PDBe:7c06, PDBj:7c06
PDBsum7c06
PubMed32958768
UniProtQ09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)

[Back to BioLiP]