Structure of PDB 7bzg Chain A Binding Site BS02

Receptor Information
>7bzg Chain A (length=110) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDIT
QKILVNQLRELEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEW
GKGYMELIDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bzg Genetically encoded formaldehyde sensors inspired by a protein intra-helical crosslinking reaction.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K23 K53 I54
Binding residue
(residue number reindexed from 1)		K22 K52 I53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7bzg, PDBe:7bzg, PDBj:7bzg
PDBsum7bzg
PubMed33495458
UniProtP42406|HXLR_BACSU HTH-type transcriptional activator HxlR (Gene Name=hxlR)

[Back to BioLiP]