Structure of PDB 7bhp Chain A Binding Site BS02

Receptor Information
>7bhp Chain A (length=322) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE
TGKIFKKEMKKGIAFPTSISVNNCVCHFSPLDYILKEGDLVKIDLGVHVD
GFIANVAHTFVVQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWN
KVAHSFNCTPIHQLKQHVIKTIIQNPTDQQKKDHEKAEFEVHEVYAVLVS
SGEKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFD
EKKARMGVVECAKHELLQPFNVLYEKGEFVAQFKFTVLLMPNGPMRITSG
PFEPDLYKSMEVQDAELKALLQ
Ligand information
>7bhp Chain B (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccccccccccccccccgggggggggggggggggg
...<.<<<<<..<<<......>>>..>>>>>.>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bhp Dynamic association of human Ebp1 with the ribosome.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K22 K62 K65 K66
Binding residue
(residue number reindexed from 1)		K13 K53 K56 K57
Enzymatic activity
Catalytic site (original residue number in PDB) D109 N120 H188 K320
Catalytic site (residue number reindexed from 1) D94 N105 H162 K284
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006364 rRNA processing
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:0045597 positive regulation of cell differentiation
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0016020 membrane
GO:0035578 azurophil granule lumen
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bhp, PDBe:7bhp, PDBj:7bhp
PDBsum7bhp
PubMed33479117
UniProtQ9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 (Gene Name=PA2G4)

[Back to BioLiP]