Structure of PDB 7b4u Chain A Binding Site BS02

Receptor Information
>7b4u Chain A (length=129) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDLGKKLLEAARAGQDDEVRILMANGADVNASDADVGATPLHLAAWAGH
LEIVEVLLKTGADVNAVDIWGLTPLHLAAAVGHLEIVEVLLKHGADVNAQ
DKFGKTPFDLAIDNGNEDIAEVLQKAAKL
Ligand information
>7b4u Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4u Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		R23 D44 V47 A49 H53 W57 D78 W80 L87 A90 F113 L120 D123 N124
Binding residue
(residue number reindexed from 1)		R13 D34 V37 A39 H43 W47 D68 W70 L77 A80 F103 L110 D113 N114
External links