Structure of PDB 7b0c Chain A Binding Site BS02

Receptor Information
>7b0c Chain A (length=144) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLTKFTDLALRSLMRLAVVRDGDEPLATREVAEVVGVPYTHAAKAITRL
QHLGVVEARRGRGGGLTLTDLGRRVSVGWLVRELEGEAEVVDCEGDNPCP
LRGACRLRRALRDAQEAFYAALDPLTVTDLVAAPTGPVLLGLTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b0c Structural determinants of DNA recognition by the NO sensor NsrR and related Rrf2-type [FeS]-transcription factors.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T4 K5 F6 P39 T41 H42 R60
Binding residue
(residue number reindexed from 1)		T4 K5 F6 P39 T41 H42 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b0c, PDBe:7b0c, PDBj:7b0c
PDBsum7b0c
PubMed35908109
UniProtQ9L132|NSRR_STRCO HTH-type transcriptional repressor NsrR (Gene Name=nsrR)

[Back to BioLiP]