Structure of PDB 7a4t Chain A Binding Site BS02

Receptor Information
>7a4t Chain A (length=121) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINVMGWYRQAPGKQRELLAS
ITSRGSTNYADSVKDRFTISRDNAKNTVYLQINSLKPEDTAVYYCNSRGW
TTTRGDYDYWGQGTQVTVSSG
Ligand information
>7a4t Chain C (length=28) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QLEDKVEELLSKNYHLENEVERLKKLVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a4t A nanobody toolbox targeting dimeric coiled-coil modules for functionalization of designed protein origami structures.
Resolution2.124 Å
Binding residue
(original residue number in PDB)		S30 I31 N32 Q44 L47 S53 N58 R98 G99
Binding residue
(residue number reindexed from 1)		S30 I31 N32 Q44 L47 S53 N58 R98 G99
External links