Structure of PDB 6zlc Chain A Binding Site BS02

Receptor Information

>6zlc Chain A (length=77) Species: 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHMSDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGR
GSTLGLDLRVATMEGKKIVEDILKSET

Ligand information

>6zlc Chain D (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agacagcauuaugcugucu

...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6zlc Structure and Sequence Determinants Governing the Interactions of RNAs with Influenza A Virus Non-Structural Protein NS1.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	P31 R38 A42 G45 R46 T49
Binding residue (residue number reindexed from 1)	P35 R42 A46 G49 R50 T53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6zlc, PDBe:6zlc, PDBj:6zlc
PDBsum	6zlc
PubMed	32867106
UniProt	Q1PST0

[Back to BioLiP]