Structure of PDB 6zfm Chain A Binding Site BS02

Receptor Information
>6zfm Chain A (length=71) Species: 8649 (Naja kaouthia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKT
GVDIQCCSTDNCNPFPTRKRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zfm Peptide Inhibitors of the alpha-Cobratoxin-Nicotinic Acetylcholine Receptor Interaction.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		T67 R68
Binding residue
(residue number reindexed from 1)		T67 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zfm, PDBe:6zfm, PDBj:6zfm
PDBsum6zfm
PubMed33143415
UniProtP01391|3L21_NAJKA Alpha-cobratoxin

[Back to BioLiP]