Structure of PDB 6z6p Chain A Binding Site BS02

Receptor Information
>6z6p Chain A (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6z6p Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z6p Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
Resolution4.43 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 P43 G44 R49 R53 K56 R63 K64 L65 R69
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 G7 R12 R16 K19 R26 K27 L28 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6z6p, PDBe:6z6p, PDBj:6z6p
PDBsum6z6p
PubMed33523989
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]