Structure of PDB 6yww Chain A Binding Site BS02

Receptor Information
>6yww Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAY
FEKVGDTSLDPNDFDFTVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yww MeCP2 is a microsatellite binding protein that protects CA repeats from nucleosome invasion.
Resolution2.102 Å
Binding residue
(original residue number in PDB)		R111 S113 G114 R115 S116 R133
Binding residue
(residue number reindexed from 1)		R20 S22 G23 R24 S25 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6yww, PDBe:6yww, PDBj:6yww
PDBsum6yww
PubMed34324427
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]