Structure of PDB 6yrq Chain A Binding Site BS02

Receptor Information
>6yrq Chain A (length=99) Species: 1980456 (Orthohantavirus andesense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVFCTLAGPGASCEAYSENGIFNISSPTCLVNKVSEQKINFICQRVDQD
VVVYCNGQKKVILTKTLVIGQCIYTFTSLFSLMPDVAHSLAVELCVPGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yrq The Hantavirus Surface Glycoprotein Lattice and Its Fusion Control Mechanism.
Resolution1.902 Å
Binding residue
(original residue number in PDB)
T380 V381 F382 C383 K443 V444 I445 L446 T449 V479
Binding residue
(residue number reindexed from 1)
T2 V3 F4 C5 K60 V61 I62 L63 T66 V96
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6yrq, PDBe:6yrq, PDBj:6yrq
PDBsum6yrq
PubMed32937107
UniProtQ9E006|GP_ANDV Envelopment polyprotein (Gene Name=GP)

[Back to BioLiP]