Structure of PDB 6yl2 Chain A Binding Site BS02

Receptor Information
>6yl2 Chain A (length=192) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLL
VELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQ
DRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVF
GLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yl2 Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R26 V57 P60 R64 H65
Binding residue
(residue number reindexed from 1)		R3 V34 P37 R41 H42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0042783 evasion of host immune response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6yl2, PDBe:6yl2, PDBj:6yl2
PDBsum6yl2
PubMed
UniProtO06169

[Back to BioLiP]