Structure of PDB 6y42 Chain A Binding Site BS02

Receptor Information

>6y42 Chain A (length=159) Species: 953739 (Streptomyces venezuelae ATCC 10712) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLSGGVEWALHCCVVLTAASRPVPAARLAELHDVSPSYLAKQMQALSRAG
LVRSVQGKTGGYVLTRPAVEITLLDVVQAVDGPDPAFVCTEIRQRGPLAT
PPEKCTKACPIARAMGAAEAAWRASLAATTIADLVATVDDESGPDALPGV
GAWLIEGLG

Ligand information

>6y42 Chain F (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

catttgactcggacacagactatccgagtattatct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6y42 Electron and Proton Transfers Modulate DNA Binding by the Transcription Regulator RsrR.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	W9 S36 S38 Y39 G58 K59
Binding residue (residue number reindexed from 1)	W8 S35 S37 Y38 G57 K58

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding
GO:0051537	2 iron, 2 sulfur cluster binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6y42, PDBe:6y42, PDBj:6y42
PDBsum	6y42
PubMed	32078310
UniProt	F2RGC9

[Back to BioLiP]