Structure of PDB 6y36 Chain A Binding Site BS02

Receptor Information

>6y36 Chain A (length=51) Species: 330879 (Aspergillus fumigatus Af293) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YVNAKQFHRILKRRVARQKLEEQLRKPYLHESRHNHAMRRPRGPGGRFLT
A

Ligand information

>6y36 Chain E (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaatccaccaatcaacgcctccgtg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6y36 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
Resolution	2.3 Å
Binding residue (original residue number in PDB)	H269 S271 R272 H275 R279 R286 F287 L288 T289
Binding residue (residue number reindexed from 1)	H30 S32 R33 H36 R40 R47 F48 L49 T50

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6y36, PDBe:6y36, PDBj:6y36
PDBsum	6y36
PubMed	32467317
UniProt	Q4X049

[Back to BioLiP]