Structure of PDB 6xy6 Chain A Binding Site BS02

Receptor Information
>6xy6 Chain A (length=135) Species: 654928 (Sheeppox virus (strain TU-V02127)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEIC
NFILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKD
ENNEVVDDDLALNELINKFSSYQKDIISFVEKNKK
Ligand information
>6xy6 Chain F (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DASTKKLSECLKRIGDELDSNMELQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xy6 Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax.
Resolution2.91415 Å
Binding residue
(original residue number in PDB)		T48 E49 E52
Binding residue
(residue number reindexed from 1)		T44 E45 E48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6xy6, PDBe:6xy6, PDBj:6xy6
PDBsum6xy6
PubMed32390192
UniProtA0A3F2YKH3

[Back to BioLiP]