Structure of PDB 6xs9 Chain A Binding Site BS02

Receptor Information
>6xs9 Chain A (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDY
LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMAS
LALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIP
SFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP
Ligand information
>6xs9 Chain E (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YIKTPLGTFPNRHG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xs9 De novo macrocyclic peptides for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		Q72 L102 Q105 F106
Binding residue
(residue number reindexed from 1)		Q74 L104 Q107 F108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006886 intracellular protein transport
GO:0010506 regulation of autophagy
GO:0015031 protein transport
GO:0032456 endocytic recycling
GO:0042147 retrograde transport, endosome to Golgi
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xs9, PDBe:6xs9, PDBj:6xs9
PDBsum6xs9
PubMed34851660
UniProtQ9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 (Gene Name=VPS29)

[Back to BioLiP]