Structure of PDB 6x2o Chain A Binding Site BS02

Receptor Information
>6x2o Chain A (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGP
IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDL
VRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFE
KPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
LPDEDDDL
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain6x2o Chain A Residue 302 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x2o Recognition of nuclear export signals by CRM1 carrying the oncogenic E571K mutation.
Resolution2.551 Å
Binding residue
(original residue number in PDB)
T24 T42
Binding residue
(residue number reindexed from 1)
T16 T34
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005049 nuclear export signal receptor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0019904 protein domain specific binding
GO:0044877 protein-containing complex binding
GO:0045296 cadherin binding
GO:0045505 dynein intermediate chain binding
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0061676 importin-alpha family protein binding
GO:0070883 pre-miRNA binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000055 ribosomal large subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0006259 DNA metabolic process
GO:0006606 protein import into nucleus
GO:0006611 protein export from nucleus
GO:0006913 nucleocytoplasmic transport
GO:0007052 mitotic spindle organization
GO:0007286 spermatid development
GO:0008104 protein localization
GO:0014070 response to organic cyclic compound
GO:0015031 protein transport
GO:0016032 viral process
GO:0021766 hippocampus development
GO:0030036 actin cytoskeleton organization
GO:0031503 protein-containing complex localization
GO:0032092 positive regulation of protein binding
GO:0035281 pre-miRNA export from nucleus
GO:0042307 positive regulation of protein import into nucleus
GO:0046039 GTP metabolic process
GO:0051301 cell division
GO:0061015 snRNA import into nucleus
GO:0071389 cellular response to mineralocorticoid stimulus
GO:1902570 protein localization to nucleolus
Cellular Component
GO:0000785 chromatin
GO:0001673 male germ cell nucleus
GO:0002177 manchette
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005814 centriole
GO:0005829 cytosol
GO:0016020 membrane
GO:0030496 midbody
GO:0032991 protein-containing complex
GO:0036126 sperm flagellum
GO:0042470 melanosome
GO:0042565 RNA nuclear export complex
GO:0055037 recycling endosome
GO:0070062 extracellular exosome
GO:0090543 Flemming body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6x2o, PDBe:6x2o, PDBj:6x2o
PDBsum6x2o
PubMed32520643
UniProtP62826|RAN_HUMAN GTP-binding nuclear protein Ran (Gene Name=RAN)

[Back to BioLiP]