Structure of PDB 6x1j Chain A Binding Site BS02

Receptor Information
>6x1j Chain A (length=226) Species: 1156965 (Wickerhamomyces canadensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IINKKDLLGLGPNSKLIKDYKKQWTTLSKIQEETLIGNILGDVYIKKLKR
NKHFLLQFEWKNKAYIEHIVRVFDEYVISPPTLYERKNHLGNKVITWRAQ
TFEHKAFDKLGYYFMENHKKIIKPDLVLNYITERSLAYWFMDDGGKWDYN
KKTKNKSLVLHTQGFKKEEVEILINDLNIKFNLNCSIKFNKNKPIIYIPN
KDYELFYNLVNPYIIPEMKYKLLFNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1j Structure-Function Studies of Two Yeast Homing Endonucleases that Evolved to Cleave Identical Targets with Dissimilar Rates and Specificities.
Resolution1.945 Å
Binding residue
(original residue number in PDB)		P17 N18 K23 K26 I83 S84 R91 R103 F107 E108 D148 Y154 H166 Q168 G169 N195
Binding residue
(residue number reindexed from 1)		P12 N13 K18 K21 I78 S79 R86 R98 F102 E103 D143 Y149 H161 Q163 G164 N190
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0000373 Group II intron splicing
GO:0006314 intron homing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x1j, PDBe:6x1j, PDBj:6x1j
PDBsum6x1j
PubMed35317996
UniProtQ34807|IEND1_WICCA Probable intron-encoded endonuclease 1

[Back to BioLiP]