Structure of PDB 6x0n Chain A Binding Site BS02

Receptor Information
>6x0n Chain A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6x0n Chain J (length=157) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgtgca
tgtattg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x0n Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 R42 P43 G44 T45 V46 A47 R49 R83
Binding residue
(residue number reindexed from 1)		H3 R4 Y5 R6 P7 G8 T9 V10 A11 R13 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6x0n, PDBe:6x0n, PDBj:6x0n
PDBsum6x0n
PubMed32939087
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]