Structure of PDB 6wmi Chain A Binding Site BS02

Receptor Information
>6wmi Chain A (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCGKSFYVLQRL
KVHMRTHNGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGC
GRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRKHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wmi ZNF410 Uniquely Activates the NuRD Component CHD4 to Silence Fetal Hemoglobin Expression.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R228 W232 H235 Y238 R247 R265 H269 T272 N295 H299 R318 E322 S325 H329 Q350
Binding residue
(residue number reindexed from 1)		R12 W16 H19 Y22 R31 R49 H53 T56 N79 H83 R102 E106 S109 H113 Q134
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wmi, PDBe:6wmi, PDBj:6wmi
PDBsum6wmi
PubMed33301730
UniProtQ86VK4|ZN410_HUMAN Zinc finger protein 410 (Gene Name=ZNF410)

[Back to BioLiP]