Structure of PDB 6vtx Chain A Binding Site BS02

Receptor Information
>6vtx Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vtx Liquid condensation of reprogramming factor KLF4 with DNA provides a mechanism for chromatin organization.
Resolution2.14 Å
Binding residue
(original residue number in PDB)
S445 Y460 S474 T478 F490
Binding residue
(residue number reindexed from 1)
S16 Y31 S45 T49 F61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6vtx, PDBe:6vtx, PDBj:6vtx
PDBsum6vtx
PubMed34552088
UniProtO43474|KLF4_HUMAN Krueppel-like factor 4 (Gene Name=KLF4)

[Back to BioLiP]