Structure of PDB 6vjw Chain A Binding Site BS02

Receptor Information
>6vjw Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vjw Catalytic mechanism of the mismatch-specific DNA glycosylase methyl-CpG-binding domain 4.
Resolution2.02 Å
Binding residue
(original residue number in PDB)
R468 K504 P505 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)
R31 K67 P68 G70 L71 Y72 D73 L74
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6vjw, PDBe:6vjw, PDBj:6vjw
PDBsum6vjw
PubMed32297632
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]