Structure of PDB 6vgg Chain A Binding Site BS02

Receptor Information
>6vgg Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGER
KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vgg Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
Resolution4.31 Å
Binding residue
(original residue number in PDB)		Q312 L313 W351 K355 K357 M360 K364 R367 A368 Y371
Binding residue
(residue number reindexed from 1)		Q8 L9 W47 K51 K53 M56 K60 R63 A64 Y67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6vgg, PDBe:6vgg, PDBj:6vgg
PDBsum6vgg
PubMed33275876
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]