Structure of PDB 6uxv Chain A Binding Site BS02

Receptor Information
>6uxv Chain A (length=140) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSNIDYQTLLANSDHAKFTIEPGVLPVGIDTHTATDIYQTLIALNLDTT
VNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNS
LLTNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKK
Ligand information
>6uxv Chain O (length=18) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uxv Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		Q577 Q584
Binding residue
(residue number reindexed from 1)		Q119 Q126
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0000182 rDNA binding
GO:0003677 DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0031492 nucleosomal DNA binding
GO:0042393 histone binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0070577 lysine-acetylated histone binding
GO:0140566 histone reader activity
GO:0140658 ATP-dependent chromatin remodeler activity
Biological Process
GO:0006261 DNA-templated DNA replication
GO:0006302 double-strand break repair
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0031496 positive regulation of mating type switching
GO:0034198 cellular response to amino acid starvation
GO:0035973 aggrephagy
GO:0042148 DNA strand invasion
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1900189 positive regulation of cell adhesion involved in single-species biofilm formation
GO:2000219 positive regulation of invasive growth in response to glucose limitation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0016514 SWI/SNF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uxv, PDBe:6uxv, PDBj:6uxv
PDBsum6uxv
PubMed32188938
UniProtP22082|SNF2_YEAST Transcription regulatory protein SNF2 (Gene Name=SNF2)

[Back to BioLiP]