Structure of PDB 6uwg Chain A Binding Site BS02

Receptor Information

>6uwg Chain A (length=298) Species: 32630 (synthetic construct)

RRESINPWILTGFADAEGSFLLRIRKNNKSSVGYSTELGFQITLHNKDKS
ILENIQSTWGVGVIANSGDNAVSLKVTRFEDLKVIIDHFEKYPLITQKYA
DYMLFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIIS
KERSLINKNIPNFKWLAGFTSGDGCFFVNLIKSKSKLGVQVQLVFSITQH
IRDKNLMNSLITYLGCGYIKKKNKSEFSWLDFVVTKFSDIRDKIIPFFQE
YTLIGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKGRVF

Ligand information

>6uwg Chain C (length=26)

cctaaaaggttgaataagtggaaacc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6uwg Optimization of Protein Thermostability and Exploitation of Recognition Behavior to Engineer Altered Protein-DNA Recognition.
• Resolution: 2.22 Å
• Binding residue (original residue number in PDB): S24 R28 R30 Q46 H50 K52 K80 K103 N139 W140 S190 Q195 Q197 K225 K227 T240 K241 F242 H281 K299
• Binding residue (residue number reindexed from 1): S19 R23 R25 Q41 H45 K47 K75 K98 N134 W135 S185 Q190 Q192 K220 K222 T235 K236 F237 H276 K294

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 15:21:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6uwg', asym_id = 'A', bs = 'BS02', title = 'Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6uwg', asym_id='A', bs='BS02', title='Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '6uwg', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='6uwg', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>