Structure of PDB 6ueo Chain A Binding Site BS02

Receptor Information
>6ueo Chain A (length=187) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVI
MRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFK
DFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIV
LLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ueo DNA mismatches reveal conformational penalties in protein-DNA recognition.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q26 N27 R56 F57 I61 R63 T70 L72 T82 V119 P149 F165 S167 K169 V171
Binding residue
(residue number reindexed from 1)		Q15 N16 R45 F46 I50 R52 T59 L61 T71 V108 P138 F154 S156 K158 V160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006352 DNA-templated transcription initiation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ueo, PDBe:6ueo, PDBj:6ueo
PDBsum6ueo
PubMed33087930
UniProtP28147|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]