Structure of PDB 6u81 Chain A Binding Site BS02

Receptor Information
>6u81 Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQ
NERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRF
PGIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u81 DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		Y43 Q64 Q68 R71 R79 R95 R96 R98 T99 R137 I140 W141 N144 R148
Binding residue
(residue number reindexed from 1)		Y25 Q46 Q50 R53 R61 R77 R78 R80 T81 R119 I122 W123 N126 R130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6u81, PDBe:6u81, PDBj:6u81
PDBsum6u81
PubMed32020675
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]