Structure of PDB 6u7t Chain A Binding Site BS02

Receptor Information

>6u7t Chain A (length=349) Species: 1422 (Geobacillus stearothermophilus)

RFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIP
YFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRY
GGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFL
VTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCL
LCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKR
DSTGLLANLWEFPSCETDGADGKEKLEQMVGEQELTEPIVSFEHAFSHLV
WQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>6u7t Chain C (length=10)

gtccacgtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6u7t Structural Basis for Finding OG Lesions and Avoiding Undamaged G by the DNA Glycosylase MutY.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): L46 Q47 Q48 R50 V51 G122 G124 P125 Y126 T127 D144 G145 R149
• Binding residue (residue number reindexed from 1): L40 Q41 Q42 R44 V45 G116 G118 P119 Y120 T121 D138 G139 R143
• Binding affinity: PDBbind-CN: Kd<5pM

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 Y126 D144
• Catalytic site (residue number reindexed from 1): E37 Y120 D138
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:6u7t, PDBe:6u7t, PDBj:6u7t
• PDBsum: 6u7t
• PubMed: 31829624
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)