Structure of PDB 6ts3 Chain A Binding Site BS02

Receptor Information
>6ts3 Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSG
PGSVPGALDYAAFSSALYGESDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ts3 EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
Resolution1.28 Å
Binding residue
(original residue number in PDB)
D826 Q830
Binding residue
(residue number reindexed from 1)
D5 Q9
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ts3, PDBe:6ts3, PDBj:6ts3
PDBsum6ts3
PubMed
UniProtP35609|ACTN2_HUMAN Alpha-actinin-2 (Gene Name=ACTN2)

[Back to BioLiP]