Structure of PDB 6tbt Chain A Binding Site BS02

Receptor Information
>6tbt Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGL
FYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVM
ATAMYLQMEHVVDTCRKFIKASE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tbt Structural basis of Apt48 inhibition of the BCL6 BTB domain.
Resolution1.63 Å
Binding residue
(original residue number in PDB)
Q8 I9 Q10 T12 R13
Binding residue
(residue number reindexed from 1)
Q2 I3 Q4 T6 R7
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6tbt, PDBe:6tbt, PDBj:6tbt
PDBsum6tbt
PubMed34774129
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]