Structure of PDB 6t78 Chain A Binding Site BS02

Receptor Information
>6t78 Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEK
IPFIREAERLRLKHMADYPDYKYRPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t78 Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function.
Resolution2.504 Å
Binding residue
(original residue number in PDB)		K50 R51 M53 M57 K61 R64 M68 N76 Y118 P120 R121
Binding residue
(residue number reindexed from 1)		K5 R6 M8 M12 K16 R19 M23 N31 Y73 P75 R76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6t78, PDBe:6t78, PDBj:6t78
PDBsum6t78
PubMed32350470
UniProtP35716|SOX11_HUMAN Transcription factor SOX-11 (Gene Name=SOX11)

[Back to BioLiP]