Structure of PDB 6t1f Chain A Binding Site BS02

Receptor Information

>6t1f Chain A (length=191) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SREAPIEILQRNPDTFREEDLEDLSNSIREKGVLQPILVRPSPDTAGEYQ
IVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEE
ALSYKVLMEKFERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGE
LTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPN

Ligand information

>6t1f Chain F (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggatgtttcacgtgaaacatcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t1f A CTP-dependent gating mechanism enables ParB spreading on DNA.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	S172 S174 G201 H202 R204 S225 V226 R227
Binding residue (residue number reindexed from 1)	S125 S127 G154 H155 R157 S178 V179 R180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6t1f, PDBe:6t1f, PDBj:6t1f
PDBsum	6t1f
PubMed	34397383
UniProt	B8GW30\|PARB_CAUVN Chromosome-partitioning protein ParB (Gene Name=parB)

[Back to BioLiP]