Structure of PDB 6s5h Chain A Binding Site BS02

Receptor Information
>6s5h Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALK
VLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFE
AVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQNGLKMDQFCKEHGFVGWF
ETSAKENINIDEASRCLVKHILANE
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain6s5h Chain A Residue 311 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s5h Structure of the human RAB38 in complex with GTP
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T23 T41
Binding residue
(residue number reindexed from 1)		T24 T42
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0030742 GTP-dependent protein binding
GO:0035612 AP-2 adaptor complex binding
GO:0035650 AP-1 adaptor complex binding
GO:0035651 AP-3 adaptor complex binding
GO:0036461 BLOC-2 complex binding
Biological Process
GO:0006886 intracellular protein transport
GO:0007005 mitochondrion organization
GO:0007264 small GTPase-mediated signal transduction
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0032438 melanosome organization
GO:0035646 endosome to melanosome transport
GO:0048023 positive regulation of melanin biosynthetic process
GO:0060155 platelet dense granule organization
GO:0072657 protein localization to membrane
GO:0090383 phagosome acidification
GO:1903232 melanosome assembly
GO:1904377 positive regulation of protein localization to cell periphery
GO:2001247 positive regulation of phosphatidylcholine biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005764 lysosome
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031905 early endosome lumen
GO:0031982 vesicle
GO:0033162 melanosome membrane
GO:0042470 melanosome
GO:0043231 intracellular membrane-bounded organelle
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0044297 cell body
GO:0045335 phagocytic vesicle
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s5h, PDBe:6s5h, PDBj:6s5h
PDBsum6s5h
PubMed
UniProtP57729|RAB38_HUMAN Ras-related protein Rab-38 (Gene Name=RAB38)

[Back to BioLiP]