Structure of PDB 6s48 Chain A Binding Site BS02

Receptor Information

>6s48 Chain A (length=235) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFIQNAAEIAKKAMDSVDPSLSEKFTIVIRFLTDNPDAASALKGKERSIV
GTEEYIIASATNFKKGRDPRTPLPPSTIPDEMVSVILNKYFEVPSEELEK
AEEWHRLSMGAENIVGDLLERYIAEVIEPHGWIWCSGSMVRAVDFIYCDS
ENVWQSLQVKNRDNTENSSSAAIRHGTPIKKWFRTFSKKRGDNWDKFPSL
EGKENLSEKGFKLYVEKYLSALRAIKALEHHHHHH

Ligand information

>6s48 Chain D (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6s48 Restriction endonucleases that cleave RNA/DNA heteroduplexes bind dsDNA in A-like conformation.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	N170 S171
Binding residue (residue number reindexed from 1)	N167 S168

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6s48, PDBe:6s48, PDBj:6s48
PDBsum	6s48
PubMed	32459314
UniProt	Q8YYB7

[Back to BioLiP]