Structure of PDB 6s16 Chain A Binding Site BS02

Receptor Information
>6s16 Chain A (length=158) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMVVAGIDPGITHLGLGVVAVELKARLLHGEVVKTSPQEPAKERVGRIHA
RVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVY
AYGPMQVKQALAGKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYA
RMGTAKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s16 RuvC uses dynamic probing of the Holliday junction to achieve sequence specificity and efficient resolution.
Resolution3.409 Å
Binding residue
(original residue number in PDB)		R76 Q77
Binding residue
(residue number reindexed from 1)		R73 Q74
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
Cellular Component
GO:0005737 cytoplasm
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s16, PDBe:6s16, PDBj:6s16
PDBsum6s16
PubMed31506434
UniProtQ5SJC4|RUVC_THET8 Crossover junction endodeoxyribonuclease RuvC (Gene Name=ruvC)

[Back to BioLiP]