Structure of PDB 6ryi Chain A Binding Site BS02

Receptor Information
>6ryi Chain A (length=59) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFY
WFQNHKARE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ryi Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL.
Resolution2.691 Å
Binding residue
(original residue number in PDB)		R38 W39 K82 N83 Y86 N90 R94
Binding residue
(residue number reindexed from 1)		R2 W3 K46 N47 Y50 N54 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0099402 plant organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ryi, PDBe:6ryi, PDBj:6ryi
PDBsum6ryi
PubMed32376862
UniProtQ9SB92|WUS_ARATH Protein WUSCHEL (Gene Name=WUS)

[Back to BioLiP]