Structure of PDB 6qil Chain A Binding Site BS02

Receptor Information
>6qil Chain A (length=115) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPN
LDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRR
ERVETIVADDAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qil Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N49 H50 G51 R52 N56 K73 R74
Binding residue
(residue number reindexed from 1)		N43 H44 G45 R46 N50 K67 R68
Binding affinityPDBbind-CN: Kd=49.32nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qil, PDBe:6qil, PDBj:6qil
PDBsum6qil
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]