Structure of PDB 6pcp Chain A Binding Site BS02

Receptor Information

>6pcp Chain A (length=140) Species: 520 (Bordetella pertussis)

PGPYHFSEQVGHLLRRAYQRHVAIFQQTIPDSKLTAAQFVVLCALRDQGA
CSLVDVVKATAIDQATVRGVIERLKARKLLAVSHDPADRRKVLVTLTPDG
RALVEEMVPFAEQITQSTFGGLNPAERVAIVYLLRKMSDA

Ligand information

• Ligand ID: OA7
• InChI: InChI=1S/C6H5NO3/c8-5-2-1-4(3-7-5)6(9)10/h1-3H,(H,7,8)(H,9,10)
• InChIKey: BLHCMGRVFXRYRN-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01: c1cc(O)ncc1C(O)=O
  OpenEye OEToolkits 2.0.7: c1cc(ncc1C(=O)O)O
  CACTVS 3.385: OC(=O)c1ccc(O)nc1
• Formula: C6 H5 N O3
• Name: 6-hydroxypyridine-3-carboxylic acid;
  6-hydroxynicotinic acid
• ChEMBL: CHEMBL95293
• ZINC: ZINC000008576188
• PDB chain: 6pcp Chain A Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6pcp Structural mechanism for regulation of DNA binding of BpsR, a Bordetella regulator of biofilm formation, by 6-hydroxynicotinic acid.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): H32 F36 V51
• Binding residue (residue number reindexed from 1): H21 F25 V40
• Annotation score: 1

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 09:46:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6pcp', asym_id = 'A', bs = 'BS02', title = 'Structural mechanism for regulation of DNA bindi...f biofilm formation, by 6-hydroxynicotinic acid. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6pcp', asym_id='A', bs='BS02', title='Structural mechanism for regulation of DNA bindi...f biofilm formation, by 6-hydroxynicotinic acid. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003700,0006355', uniprot = '', pdbid = '6pcp', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003700,0006355', uniprot='', pdbid='6pcp', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>