Structure of PDB 6pax Chain A Binding Site BS02

Receptor Information
>6pax Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCV
SKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIR
DRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pax Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N6 Q7 F12 G15 R16 L18 S46 C49 K52 R56 P65 R66 A67 I68 G69 F95 A96 W97 R125
Binding residue
(residue number reindexed from 1)		N6 Q7 F12 G15 R16 L18 S46 C49 K52 R56 P65 R66 A67 I68 G69 F95 A96 W97 R125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6pax, PDBe:6pax, PDBj:6pax
PDBsum6pax
PubMed10346815
UniProtP26367|PAX6_HUMAN Paired box protein Pax-6 (Gene Name=PAX6)

[Back to BioLiP]