Structure of PDB 6p0s Chain A Binding Site BS02

Receptor Information
>6p0s Chain A (length=83) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDVLTVSTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDM
VMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p0s Cooperative DNA binding by proteins through DNA shape complementarity.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		N73 Q74 T75 R85 R89 N98
Binding residue
(residue number reindexed from 1)		N58 Q59 T60 R70 R74 N83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0044374 sequence-specific DNA binding, bending
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0009314 response to radiation
GO:0032359 provirus excision
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045911 positive regulation of DNA recombination
GO:0051276 chromosome organization
Cellular Component
GO:0000786 nucleosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0031421 invertasome
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6p0s, PDBe:6p0s, PDBj:6p0s
PDBsum6p0s
PubMed31616952
UniProtP0A6R3|FIS_ECOLI DNA-binding protein Fis (Gene Name=fis)

[Back to BioLiP]