Structure of PDB 6p0g Chain A Binding Site BS02

Receptor Information
>6p0g Chain A (length=173) Species: 593117 (Thermococcus gammatolerans EJ3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQLFIIGIGTGTDEYENFEETILKGVKRNELEGQIGPDILDNCCSDVCYF
WGRSKETIYEKKIDKGDMVLFYVGKRISRNKVDLNQETAVYLGIICETVE
ISENDVSFLNDFWRKGENFRFLMFFKKKPEKLHHSINEINSKLGYNPDYF
PIAGYVKPERMSGVYDILKNILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p0g The structure of theThermococcus gammatoleransMcrB N-terminal domain reveals a new mode of substrate recognition and specificity among McrB homologs.
Resolution2.27 Å
Binding residue
(original residue number in PDB)		Y61 N82 K83 Y147 N148 Y151 Y157 K159 R162
Binding residue
(residue number reindexed from 1)		Y59 N80 K81 Y145 N146 Y149 Y155 K157 R160
Binding affinityPDBbind-CN: Kd=0.707uM
Enzymatic activity
Enzyme Commision number ?
External links