Structure of PDB 6ozj Chain A Binding Site BS02

Receptor Information
>6ozj Chain A (length=242) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
KSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELV
QRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLL
QVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLY
VSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozj Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.247 Å
Binding residue
(original residue number in PDB)		K57 H202 S203 T204 K205 F230 R231 R237 R248
Binding residue
(residue number reindexed from 1)		K51 H194 S195 T196 K197 F222 R223 R229 R240
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozj, PDBe:6ozj, PDBj:6ozj
PDBsum6ozj
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]